PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K03010.1.p
Common NameEUGRSUZ_K03010, LOC104426404
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 361aa    MW: 38725.5 Da    PI: 5.3151
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K03010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-175499147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +g+W++eEd +l ++v ++G+++W++Iar +  gR++k+c++rw + 
  Eucgr.K03010.1.p 54 KGPWSPEEDAILSQLVSKFGPRNWSLIARGIA-GRSGKSCRLRWCNQ 99
                      79******************************.***********985 PP

2Myb_DNA-binding57.72.6e-18106150147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       r+++T eEd +++ a++ +G++ W++Iar ++ gRt++ +k++w++ 
  Eucgr.K03010.1.p 106 RKPFTDEEDRIIIAAHAIHGNK-WASIARLLP-GRTDNAIKNHWNST 150
                       789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.20349100IPR017930Myb domain
SuperFamilySSF466898.99E-3151147IPR009057Homeodomain-like
SMARTSM007171.2E-1553102IPR001005SANT/Myb domain
PfamPF002491.1E-165499IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2655107IPR009057Homeodomain-like
CDDcd001678.21E-155698No hitNo description
PROSITE profilePS5129427.815101155IPR017930Myb domain
SMARTSM007171.6E-17105153IPR001005SANT/Myb domain
PfamPF002491.5E-15106150IPR001005SANT/Myb domain
CDDcd001671.59E-13108151No hitNo description
Gene3DG3DSA:1.10.10.605.4E-24108154IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MEPETEDPAA NEVDGADGGG EDARSGDEAE AAAAGGGNDG SGSSGGKAGR DRVKGPWSPE  60
EDAILSQLVS KFGPRNWSLI ARGIAGRSGK SCRLRWCNQL DPAVKRKPFT DEEDRIIIAA  120
HAIHGNKWAS IARLLPGRTD NAIKNHWNST LRRRSTELEK IKVEGSNTVD DASLDRVKAS  180
SEETLSCGEA NSPKSLEGKD VSSLENTSNQ YEEKSMQKDQ FNHGPKGQPT LFRPVARVSA  240
FNAYNRSDGP QPALPFVGSV PASEHIGQAL KQDHGFSRLL NDVYGERLVP HNCGYGCCDG  300
NNAAGAQNSL LGPEFVEYLE PQSFPNYELA SIAADISNLA WLRSGLDNNS VRTKDDRAGH  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-41531543104C-Myb DNA-Binding Domain
1msf_C2e-41531543104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00337DAPTransfer from AT3G09230Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K03010.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037759.10.0PREDICTED: myb-related protein A
TrEMBLA0A059A7640.0A0A059A764_EUCGR; Uncharacterized protein
STRINGVIT_08s0007g01540.t011e-151(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84922636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.11e-107myb domain protein 1